2.70 Rating by CuteStat

It is a domain having org extension. It has a global traffic rank of #7308430 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, ssidcon.org is SAFE to browse.

PageSpeed Score
8
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 115
Daily Pageviews: 230

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: 122
Bing Indexed Pages: 1,780

Search Engine Backlinks

Google Backlinks: 1,530
Bing Backlinks: 146

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 7,308,430
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

103.24.200.143

Hosted Country:

India IN

Location Latitude:

21.9974

Location Longitude:

79.0011
:: SS Infrastructure - Welcome ::

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 7
H3 Headings: 7 H4 Headings: 15
H5 Headings: 2 H6 Headings: 2
Total IFRAMEs: Not Applicable Total Images: 27
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 103.24.200.143)

web designing company Hyderabad, web designing in Hyderabad ,web desig

- outlinedesigns.in

web Design Company Hyderabad , Affordable Web site designer, web application development and Solutions company, website developers, Web Designing Company Hyderabad, web designing in Hyderabad ,Vijayawada, web design services Hyderabad, website design services Hyderabad

Not Applicable $ 8.95

.:: Immigration Assistance|Infrastructure|Project Management|Applicati

- eforcesol.com

Immigration Assistance,Infrastructure,Project Management,Application Development,ERP,CRM,Engineering Services,QA Testing,eForce Solutions

Not Applicable $ 8.95


.:: SRI SUBRAHMANYASWAMY DEVALAYAM SKANDAGIRI ::.

- srisubrahmanyaswamydevalayamskandagiri.org
1,706,079 $ 720.00

Medinova, Kolkata: serology, endocrinology, ultrasound investigations

- medinovaindia.com

Medinova Diagnostics: aematology, micro-biology, histopathology, serology, endocrinology, ultrasound investigations imaging systems, colour dopplers, ECG Machines, cardiac stress system, blood test, CT scan, MRI Scan. lab, radiology, imageology, cardiology gastroscopy, aematology, micro-biology, histopathology, serolog

5,159,456 $ 240.00

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Fri, 27 Dec 2019 03:39:37 GMT
Server: Apache
Last-Modified: Tue, 03 Dec 2019 11:20:20 GMT
Accept-Ranges: bytes
Content-Length: 32685
Content-Type: text/html

Domain Nameserver Information

Host IP Address Country
ns1.lazybulls.com 103.24.200.143 India India
ns2.lazybulls.com 103.24.202.176 India India

DNS Record Analysis

Host Type TTL Extra
ssidcon.org A 10799 IP: 103.24.200.143
ssidcon.org NS 86400 Target: ns2.lazybulls.com
ssidcon.org NS 86400 Target: ns1.lazybulls.com
ssidcon.org SOA 10800 MNAME: ns1.lazybulls.com
RNAME: root.i-h1-cs-r04-i0117-141.webazilla.com
Serial: 2019061802
Refresh: 3600
Retry: 1800
Expire: 1209600
Minimum TTL: 86400
ssidcon.org MX 14400 Priority: 10
Target: alt4.aspmx.l.google.com
ssidcon.org MX 14400 Priority: 1
Target: aspmx.l.google.com
ssidcon.org MX 14400 Priority: 5
Target: alt1.aspmx.l.google.com
ssidcon.org MX 14400 Priority: 5
Target: alt2.aspmx.l.google.com
ssidcon.org MX 14400 Priority: 10
Target: alt3.aspmx.l.google.com
ssidcon.org TXT 3600 TXT: v=spf1 ip4:103.24.200.143
ip4:103.24.200.141
include:_spf.google.com ~all

Similarly Ranked Websites

Traktör Yedek Parça

- traktoryedekparcam.com

Traktör Yedek Parça Massey Ferguson,New Holland,Tümosan,Case,Erkunt Yedek Parçaları

7,308,446 $ 240.00

Semaphore Group of Companies

- semaphoreindia.com

Semaphore Group of Companies

7,308,453 $ 240.00

icdhcolombia.org -&nbspicdhcolombia Resources and Information.

- icdhcolombia.org

icdhcolombia.org is your first and best source for all of the information you’re looking for. From general topics to more of what you would expect to find here, icdhcolombia.org has it all. We hope you find what you are searching for!

7,308,462 $ 240.00

Africa Recruitment Solutions

- africarecruitments.com

We are a global recruitment solutions company, with Africa in our heart & mind. We provide organizations with recruitment solutions & services to meet their workforce needs across Africa and beyond.

7,308,465 $ 240.00

OIVO iPhone charger - Power in Your Pocket

- oivo.pw

Meet Oivo, iPhone charger on the go. No cables, no AC power, just add AA batteries. Back us on Kickstarter!

7,308,469 $ 240.00